SCOP 1.57: Domain d1mne_1: 1mne 34-79

Lineage for d1mne_1 (1mne 34-79)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries)

8. Domain d1mne_1: 1mne 34-79 [24590]
   Other proteins in same PDB: d1mne_2

Details for d1mne_1

PDB Entry: 1mne, 2.7 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mg-pyrophosphate

SCOP Domain Sequences for d1mne_1:

Sequence; same for both SEQRES and ATOM records:

>d1mne_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Timeline for d1mne_1:

• d1mne_1 first appeared (with stable ids) in SCOP 1.55
  
• d1mne_1 appears in SCOP 1.59
  
• d1mne_1 appears in the current release, SCOPe 2.08, called d1mnea1