SCOPe 2.08: Domain d1mnea1: 1mne A:34-79

Lineage for d1mnea1 (1mne A:34-79)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)

8. Domain d1mnea1: 1mne A:34-79 [24590]
   Other proteins in same PDB: d1mnea2
   complexed with mg, pop

Details for d1mnea1

PDB Entry: 1mne, 2.7 Å

PDB Description: truncated head of myosin from dictyostelium discoideum complexed with mg-pyrophosphate

PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1mnea1:

Sequence; same for both SEQRES and ATOM records:

>d1mnea1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Timeline for d1mnea1:

• d1mnea1 first appeared (with stable ids) in SCOP 1.55, called d1mne_1
  
• d1mnea1 appears in SCOPe 2.07