![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) ![]() |
![]() | Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
![]() | Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries) |
![]() | Domain d1mnea1: 1mne A:34-79 [24590] Other proteins in same PDB: d1mnea2 complexed with mg, pop |
PDB Entry: 1mne (more details), 2.7 Å
SCOPe Domain Sequences for d1mnea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mnea1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} yiwynpdpderdsyecgeivsetsdsftfktvdgqdrqvkkddanq
Timeline for d1mnea1: