Lineage for d3er8a_ (3er8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129955Protein Polymerase regulatory subunit VP39 [53361] (2 species)
  7. 2129956Species Vaccinia virus wr [TaxId:10254] [224905] (2 PDB entries)
  8. 2129958Domain d3er8a_: 3er8 A: [245899]
    Other proteins in same PDB: d3er8c_, d3er8d_
    automated match to d3er9a_
    protein/DNA complex; protein/RNA complex

Details for d3er8a_

PDB Entry: 3er8 (more details), 3.18 Å

PDB Description: Crystal structure of the heterodimeric vaccinia virus mRNA polyadenylate polymerase complex with two fragments of RNA
PDB Compounds: (A:) Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase

SCOPe Domain Sequences for d3er8a_:

Sequence, based on SEQRES records: (download)

>d3er8a_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus wr [TaxId: 10254]}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvasaaggnepstadllsnyalqnvmisilnpvasslkwrcpf
pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

Sequence, based on observed residues (ATOM records): (download)

>d3er8a_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus wr [TaxId: 10254]}
mdvvsldkpfmyfeeidneldyepesklpyqgqlklllgelfflsklqrhgildgatvvy
igsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylrsikk
qlhpskiilisdvasgnepstadllsnyalqnvmisilnpvasslkwrcpfpdqwikdfy
iphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnkvvv
nfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

SCOPe Domain Coordinates for d3er8a_:

Click to download the PDB-style file with coordinates for d3er8a_.
(The format of our PDB-style files is described here.)

Timeline for d3er8a_: