| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d3eo1j2: 3eo1 J:108-215 [245895] Other proteins in same PDB: d3eo1a1, d3eo1c_, d3eo1d1, d3eo1f_, d3eo1g1, d3eo1i_, d3eo1j1, d3eo1l_ automated match to d1dn0a2 |
PDB Entry: 3eo1 (more details), 3.1 Å
SCOPe Domain Sequences for d3eo1j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eo1j2 b.1.1.2 (J:108-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d3eo1j2: