![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
![]() | Protein TGF-beta3 [57508] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57509] (5 PDB entries) |
![]() | Domain d3eo1i_: 3eo1 I: [245893] Other proteins in same PDB: d3eo1a1, d3eo1a2, d3eo1d1, d3eo1d2, d3eo1g1, d3eo1g2, d3eo1j1, d3eo1j2 automated match to d1tgja_ |
PDB Entry: 3eo1 (more details), 3.1 Å
SCOPe Domain Sequences for d3eo1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eo1i_ g.17.1.2 (I:) TGF-beta3 {Human (Homo sapiens) [TaxId: 9606]} aldtnycfrnleenccvrplyidfrqdlgwkwvhepkgyyanfcsgpcpylrsadtthst vlglyntlnpeasaspccvpqdlepltilyyvgrtpkveqlsnmvvksckcs
Timeline for d3eo1i_: