![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
![]() | Domain d3eo1g2: 3eo1 G:108-215 [245892] Other proteins in same PDB: d3eo1a1, d3eo1c_, d3eo1d1, d3eo1f_, d3eo1g1, d3eo1i_, d3eo1j1, d3eo1l_ automated match to d1dn0a2 |
PDB Entry: 3eo1 (more details), 3.1 Å
SCOPe Domain Sequences for d3eo1g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eo1g2 b.1.1.2 (G:108-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d3eo1g2: