| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) ![]() |
| Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
| Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
| Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries) |
| Domain d1d1aa1: 1d1a A:34-79 [24589] Other proteins in same PDB: d1d1aa2 complexed with dae, mg |
PDB Entry: 1d1a (more details), 2 Å
SCOPe Domain Sequences for d1d1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1aa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq
Timeline for d1d1aa1: