Lineage for d1d1aa1 (1d1a A:34-79)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796467Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 796468Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 796469Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 796503Species Dictyostelium discoideum [TaxId:44689] [50089] (21 PDB entries)
  8. 796520Domain d1d1aa1: 1d1a A:34-79 [24589]
    Other proteins in same PDB: d1d1aa2

Details for d1d1aa1

PDB Entry: 1d1a (more details), 2 Å

PDB Description: dictyostelium myosin s1dc (motor domain fragment) complexed with o,p- dinitrophenyl aminoethyldiphosphate beryllium trifluoride.
PDB Compounds: (A:) myosin

SCOP Domain Sequences for d1d1aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1aa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Dictyostelium discoideum [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

SCOP Domain Coordinates for d1d1aa1:

Click to download the PDB-style file with coordinates for d1d1aa1.
(The format of our PDB-style files is described here.)

Timeline for d1d1aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d1aa2