Lineage for d1d1aa1 (1d1a A:34-79)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13205Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 13206Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 13207Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 13229Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries)
  8. 13243Domain d1d1aa1: 1d1a A:34-79 [24589]
    Other proteins in same PDB: d1d1aa2

Details for d1d1aa1

PDB Entry: 1d1a (more details), 2 Å

PDB Description: dictyostelium myosin s1dc (motor domain fragment) complexed with o,p- dinitrophenyl aminoethyldiphosphate beryllium trifluoride.

SCOP Domain Sequences for d1d1aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1aa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

SCOP Domain Coordinates for d1d1aa1:

Click to download the PDB-style file with coordinates for d1d1aa1.
(The format of our PDB-style files is described here.)

Timeline for d1d1aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d1aa2