SCOPe 2.08: Domain d3eo1d2: 3eo1 D:108-215

Lineage for d3eo1d2 (3eo1 D:108-215)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d3eo1d2: 3eo1 D:108-215 [245889]
Other proteins in same PDB: d3eo1a1, d3eo1c_, d3eo1d1, d3eo1f_, d3eo1g1, d3eo1i_, d3eo1j1, d3eo1l_
automated match to d1dn0a2

Details for d3eo1d2

PDB Entry: 3eo1 (more details), 3.1 Å

PDB Description: Structure of the Fab Fragment of GC-1008 in Complex with Transforming Growth Factor-Beta 3

PDB Compounds: (D:) GC-1008 Fab Light Chain

SCOPe Domain Sequences for d3eo1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eo1d2 b.1.1.2 (D:108-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3eo1d2:

Click to download the PDB-style file with coordinates for d3eo1d2.
(The format of our PDB-style files is described here.)

Timeline for d3eo1d2: