SCOPe 2.07: Domain d3eo1a2: 3eo1 A:108-215

Lineage for d3eo1a2 (3eo1 A:108-215)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d3eo1a2: 3eo1 A:108-215 [245886]
   Other proteins in same PDB: d3eo1a1, d3eo1c_, d3eo1d1, d3eo1f_, d3eo1g1, d3eo1i_, d3eo1j1, d3eo1l_
   automated match to d1dn0a2

Details for d3eo1a2

PDB Entry: 3eo1, 3.1 Å

PDB Description: Structure of the Fab Fragment of GC-1008 in Complex with Transforming Growth Factor-Beta 3

PDB Compounds: (A:) GC-1008 Fab Light Chain

SCOPe Domain Sequences for d3eo1a2:

Sequence; same for both SEQRES and ATOM records:

>d3eo1a2 b.1.1.2 (A:108-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d3eo1a2:

• d3eo1a2 first appeared in SCOPe 2.04
  
• d3eo1a2 appears in SCOPe 2.06
  
• d3eo1a2 appears in the current release, SCOPe 2.08