Lineage for d1d1ca1 (1d1c A:34-79)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393289Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2393290Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2393291Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2393324Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)
  8. 2393335Domain d1d1ca1: 1d1c A:34-79 [24588]
    Other proteins in same PDB: d1d1ca2
    complexed with mg, nmq

Details for d1d1ca1

PDB Entry: 1d1c (more details), 2.3 Å

PDB Description: dictyostelium myosin s1dc (motor domain fragment) complexed with n- methyl-o-nitrophenyl aminoethyldiphosphate beryllium trifluoride.
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1d1ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ca1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

SCOPe Domain Coordinates for d1d1ca1:

Click to download the PDB-style file with coordinates for d1d1ca1.
(The format of our PDB-style files is described here.)

Timeline for d1d1ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d1ca2