SCOPe 2.04: Domain d1d1ca1: 1d1c A:34-79

Lineage for d1d1ca1 (1d1c A:34-79)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)

8. Domain d1d1ca1: 1d1c A:34-79 [24588]
   Other proteins in same PDB: d1d1ca2
   complexed with mg, nmq

Details for d1d1ca1

PDB Entry: 1d1c, 2.3 Å

PDB Description: dictyostelium myosin s1dc (motor domain fragment) complexed with n- methyl-o-nitrophenyl aminoethyldiphosphate beryllium trifluoride.

PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1d1ca1:

Sequence; same for both SEQRES and ATOM records:

>d1d1ca1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Timeline for d1d1ca1:

• d1d1ca1 first appeared (with stable ids) in SCOP 1.55
  
• d1d1ca1 appears in SCOPe 2.03
  
• d1d1ca1 appears in SCOPe 2.05
  
• d1d1ca1 appears in the current release, SCOPe 2.08