Lineage for d3emba_ (3emb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895139Species Wesselsbron virus [TaxId:164416] [255820] (6 PDB entries)
  8. 2895144Domain d3emba_: 3emb A: [245879]
    automated match to d2px5a_
    protein/RNA complex; complexed with gtg, sam, so4

Details for d3emba_

PDB Entry: 3emb (more details), 2.3 Å

PDB Description: Wesselsbron virus Methyltransferase in complex with AdoMet and 7MeGpppG
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d3emba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3emba_ c.66.1.0 (A:) automated matches {Wesselsbron virus [TaxId: 164416]}
vtlgevwkrqlnmlgkqeferykvsditevdrtaarrylkegrtdvgisvsrgaakirwl
hergylritgrvldlgcgrggwsyyaaaqkevmsvkgytlgieghekpihmqtlgwnivk
fkdksnvftmptepsdtllcdigesssnplverdrtmkvlenferwkhvntenfcvkvla
pyhpdvieklerlqlrfgggivrvpfsrnsthemyyisgarnnithmvnttsrsllrrmt
rpsgkaiiegdvflptgtrs

SCOPe Domain Coordinates for d3emba_:

Click to download the PDB-style file with coordinates for d3emba_.
(The format of our PDB-style files is described here.)

Timeline for d3emba_: