Lineage for d3elwa_ (3elw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502793Species Wesselsbron virus [TaxId:164416] [255820] (6 PDB entries)
  8. 2502794Domain d3elwa_: 3elw A: [245877]
    automated match to d2px5a_
    protein/RNA complex; complexed with gp3, sam, so4

Details for d3elwa_

PDB Entry: 3elw (more details), 1.9 Å

PDB Description: Wesselsbron virus Methyltransferase in complex with AdoMet and GpppG
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d3elwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3elwa_ c.66.1.0 (A:) automated matches {Wesselsbron virus [TaxId: 164416]}
vtlgevwkrqlnmlgkqeferykvsditevdrtaarrylkegrtdvgisvsrgaakirwl
hergylritgrvldlgcgrggwsyyaaaqkevmsvkgytlgieghekpihmqtlgwnivk
fkdksnvftmptepsdtllcdigesssnplverdrtmkvlenferwkhvntenfcvkvla
pyhpdvieklerlqlrfgggivrvpfsrnsthemyyisgarnnithmvnttsrsllrrmt
rpsgkaiiegdvflptgtrsv

SCOPe Domain Coordinates for d3elwa_:

Click to download the PDB-style file with coordinates for d3elwa_.
(The format of our PDB-style files is described here.)

Timeline for d3elwa_: