SCOPe 2.08: Domain d3eiva_: 3eiv A:

Lineage for d3eiva_ (3eiv A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (10 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [255819] (1 PDB entry)

8. Domain d3eiva_: 3eiv A: [245870]
   automated match to d1ue1b_

Details for d3eiva_

PDB Entry: 3eiv, 2.14 Å

PDB Description: Crystal Structure of Single-stranded DNA-binding protein from Streptomyces coelicolor

PDB Compounds: (A:) Single-stranded DNA-binding protein 2

SCOPe Domain Sequences for d3eiva_:

Sequence, based on SEQRES records:

>d3eiva_ b.40.4.3 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
etvitvvgnlvddpelrftpsgaavakfrvastprtfdrqtnewkdgeslfltcsvwrqa
aenvaeslqrgmrvivqgrlkqrsyedregvkrtvyeldvdevgaslrsatakvtkt

Sequence, based on observed residues (ATOM records):

>d3eiva_ b.40.4.3 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
etvitvvgnlvddpelrftpsgaavakfrvastpdgeslfltcsvwrqaaenvaeslqrg
mrvivqgrlkqrsrtvyeldvdevgaslrsatakvtkt

Timeline for d3eiva_:

• d3eiva_ first appeared in SCOPe 2.04
  
• d3eiva_ appears in SCOPe 2.07