Lineage for d1mmaa1 (1mma A:34-79)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393289Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2393290Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2393291Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2393324Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)
  8. 2393338Domain d1mmaa1: 1mma A:34-79 [24587]
    Other proteins in same PDB: d1mmaa2
    complexed with adp, mg

Details for d1mmaa1

PDB Entry: 1mma (more details), 2.1 Å

PDB Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1mmaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmaa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

SCOPe Domain Coordinates for d1mmaa1:

Click to download the PDB-style file with coordinates for d1mmaa1.
(The format of our PDB-style files is described here.)

Timeline for d1mmaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmaa2