SCOP 1.61: Domain d1mma_1: 1mma 34-79

Lineage for d1mma_1 (1mma 34-79)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.34: SH3-like barrel [50036] (10 superfamilies)

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)

8. Domain d1mma_1: 1mma 34-79 [24587]
   Other proteins in same PDB: d1mma_2

Details for d1mma_1

PDB Entry: 1mma, 2.1 Å

PDB Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain

SCOP Domain Sequences for d1mma_1:

Sequence; same for both SEQRES and ATOM records:

>d1mma_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

Timeline for d1mma_1:

• d1mma_1 first appeared (with stable ids) in SCOP 1.55
  
• d1mma_1 appears in SCOP 1.59
  
• d1mma_1 appears in SCOP 1.63
  
• d1mma_1 appears in the current release, SCOPe 2.08, called d1mmaa1