Lineage for d1mma_1 (1mma 34-79)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58450Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 58451Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 58452Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 58474Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries)
  8. 58486Domain d1mma_1: 1mma 34-79 [24587]
    Other proteins in same PDB: d1mma_2

Details for d1mma_1

PDB Entry: 1mma (more details), 2.1 Å

PDB Description: x-ray structures of the mgadp, mgatpgammas, and mgamppnp complexes of the dictyostelium discoideum myosin motor domain

SCOP Domain Sequences for d1mma_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mma_1 b.34.3.1 (34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktsdgqdrqvkkddanq

SCOP Domain Coordinates for d1mma_1:

Click to download the PDB-style file with coordinates for d1mma_1.
(The format of our PDB-style files is described here.)

Timeline for d1mma_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mma_2