Lineage for d3ehnb_ (3ehn B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334081Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2334082Protein automated matches [191037] (12 species)
    not a true protein
  7. 2334095Species Bacteroides thetaiotaomicron [TaxId:818] [189698] (3 PDB entries)
  8. 2334101Domain d3ehnb_: 3ehn B: [245869]
    automated match to d3gzsa_
    complexed with nlc

Details for d3ehnb_

PDB Entry: 3ehn (more details), 2.8 Å

PDB Description: BT1043 with N-acetyllactosamine
PDB Compounds: (B:) SusD homolog

SCOPe Domain Sequences for d3ehnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ehnb_ a.118.8.0 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
lgplkygarfmnmqqrvipigspslttgpgndlqntdlissgnyigyfgnnnnwgfnnea
nwnftdsrmnyayqnfysqiflpwneiyeiakdsdspseqaileianivrniawlratdv
fgpiaynsagdgsiapkfdsqevvyrsmladlsksvellntisysvmaqydliyngnvqn
wvklanslmlrivvrvhfidetlakeyitkaldpknggviedisseakikssdkmpllns
mlasvneynetrmgatiwgyldgykdprlsayftegtygsgswaqtgyfpvaptnsksks
etsysakfasrpkvdsnsplywfrasetyflkaeaalynliggdpktfyeqginisfqeq
gvsgvatylsgtgkptgltgsnykygtynhdlsigntspkwddytgnlskqeeqlqkiit
qkylalypnaveawteyrrtgfpylmkpmdeaapgrigasiedcrvperfrfaptaynsn
pnmaeiptllgggdigatklwwvrsnrpkqpn

SCOPe Domain Coordinates for d3ehnb_:

Click to download the PDB-style file with coordinates for d3ehnb_.
(The format of our PDB-style files is described here.)

Timeline for d3ehnb_: