![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
![]() | Protein automated matches [191037] (12 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [189698] (3 PDB entries) |
![]() | Domain d3ehnb_: 3ehn B: [245869] automated match to d3gzsa_ |
PDB Entry: 3ehn (more details), 2.8 Å
SCOPe Domain Sequences for d3ehnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ehnb_ a.118.8.0 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} lgplkygarfmnmqqrvipigspslttgpgndlqntdlissgnyigyfgnnnnwgfnnea nwnftdsrmnyayqnfysqiflpwneiyeiakdsdspseqaileianivrniawlratdv fgpiaynsagdgsiapkfdsqevvyrsmladlsksvellntisysvmaqydliyngnvqn wvklanslmlrivvrvhfidetlakeyitkaldpknggviedisseakikssdkmpllns mlasvneynetrmgatiwgyldgykdprlsayftegtygsgswaqtgyfpvaptnsksks etsysakfasrpkvdsnsplywfrasetyflkaeaalynliggdpktfyeqginisfqeq gvsgvatylsgtgkptgltgsnykygtynhdlsigntspkwddytgnlskqeeqlqkiit qkylalypnaveawteyrrtgfpylmkpmdeaapgrigasiedcrvperfrfaptaynsn pnmaeiptllgggdigatklwwvrsnrpkqpn
Timeline for d3ehnb_: