Lineage for d3ehmb_ (3ehm B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007586Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2007587Protein automated matches [191037] (12 species)
    not a true protein
  7. 2007600Species Bacteroides thetaiotaomicron [TaxId:818] [189698] (3 PDB entries)
  8. 2007604Domain d3ehmb_: 3ehm B: [245867]
    automated match to d3gzsa_
    complexed with edo

Details for d3ehmb_

PDB Entry: 3ehm (more details), 2 Å

PDB Description: Structure of BT1043
PDB Compounds: (B:) SusD homolog

SCOPe Domain Sequences for d3ehmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ehmb_ a.118.8.0 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
plkygarfmnmqqrvipigspslttgpgndlqntdlissgnyigyfgnnnnwgfnneanw
nftdsrmnyayqnfysqiflpwneiyeiakdsdspseqaileianivrniawlratdvfg
piaynsagdgsiapkfdsqevvyrsmladlsksvellntisysvmaqydliyngnvqnwv
klanslmlrivvrvhfidetlakeyitkaldpknggviedisseakikssdkmpllnsml
asvneynetrmgatiwgyldgykdprlsayftegtygsgswaqtgyfpvaptnskskset
sysakfasrpkvdsnsplywfrasetyflkaeaalynliggdpktfyeqginisfqeqgv
sgvatylsgtgkptgltgsnykygtynhdlsigntspkwddytgnlskqeeqlqkiitqk
ylalypnaveawteyrrtgfpylmkpmdeaapgrigasiedcrvperfrfaptaynsnpn
maeiptllgggdigatklwwvrsnrpkqpn

SCOPe Domain Coordinates for d3ehmb_:

Click to download the PDB-style file with coordinates for d3ehmb_.
(The format of our PDB-style files is described here.)

Timeline for d3ehmb_: