SCOPe 2.08: Domain d3eh3b1: 3eh3 B:3-36

Lineage for d3eh3b1 (3eh3 B:3-36)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.0: automated matches [227239] (1 protein)
   not a true family

6. Protein automated matches [226999] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries)

8. Domain d3eh3b1: 3eh3 B:3-36 [245864]
   Other proteins in same PDB: d3eh3a_, d3eh3b2, d3eh3c_
   automated match to d2qpdb2
   complexed with cu1, cua, has, hem

Details for d3eh3b1

PDB Entry: 3eh3, 3.1 Å

PDB Description: structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3eh3b1:

Sequence; same for both SEQRES and ATOM records:

>d3eh3b1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dqhkahkailayekgwlafslamlfvfialiayt

Timeline for d3eh3b1:

• d3eh3b1 first appeared in SCOPe 2.04
  
• d3eh3b1 appears in SCOPe 2.07