Lineage for d3egna_ (3egn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652682Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1652683Protein automated matches [190896] (7 species)
    not a true protein
  7. 1652701Species Human (Homo sapiens) [TaxId:9606] [188315] (59 PDB entries)
  8. 1652735Domain d3egna_: 3egn A: [245860]
    automated match to d2cpxa1

Details for d3egna_

PDB Entry: 3egn (more details), 2.5 Å

PDB Description: C-terminal RNA Recognition Motif of the U11/U12 65K Protein
PDB Compounds: (A:) RNA-binding protein 40

SCOPe Domain Sequences for d3egna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3egna_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ecisrrelekgrisreemetlsvfrsyepgepncriyvknlakhvqekdlkyifgryvdf
ssetqrimfdirlmkegrmkgqafiglpnekaaakalkeangyvlfgkpmvvqfarsarp

SCOPe Domain Coordinates for d3egna_:

Click to download the PDB-style file with coordinates for d3egna_.
(The format of our PDB-style files is described here.)

Timeline for d3egna_: