SCOPe 2.06: Domain d1fmwa1: 1fmw A:34-79

Lineage for d1fmwa1 (1fmw A:34-79)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)

8. Domain d1fmwa1: 1fmw A:34-79 [24586]
   Other proteins in same PDB: d1fmwa2
   complexed with atp, mg

Details for d1fmwa1

PDB Entry: 1fmw, 2.15 Å

PDB Description: crystal structure of the mgatp complex for the motor domain of dictyostelium myosin ii

PDB Compounds: (A:) myosin II heavy chain

SCOPe Domain Sequences for d1fmwa1:

Sequence; same for both SEQRES and ATOM records:

>d1fmwa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Timeline for d1fmwa1:

• d1fmwa1 first appeared (with stable ids) in SCOP 1.55
  
• d1fmwa1 appears in SCOPe 2.05
  
• d1fmwa1 appears in SCOPe 2.07
  
• d1fmwa1 appears in the current release, SCOPe 2.08