Lineage for d3eg4a_ (3eg4 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557864Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1557865Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1557877Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 proteins)
    contains extra N-terminal 3-helical domain
    this is a repeat family; one repeat unit is 6amy A:120-137 found in domain
  6. 1557889Protein automated matches [191042] (3 species)
    not a true protein
  7. 1557890Species Brucella suis [TaxId:29461] [255818] (1 PDB entry)
  8. 1557891Domain d3eg4a_: 3eg4 A: [245859]
    automated match to d3gosa_

Details for d3eg4a_

PDB Entry: 3eg4 (more details), 1.87 Å

PDB Description: Crystal structure of 2,3,4,5-Tetrahydropyridine-2-carboxylate N-Succinyltransferase from Brucella melitensis biovar abortus 2308
PDB Compounds: (A:) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

SCOPe Domain Sequences for d3eg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eg4a_ b.81.1.2 (A:) automated matches {Brucella suis [TaxId: 29461]}
laslektiekafderdgintatrgevreaveqslilldrgevrvaekqadgnwhvnqwlk
kavllsfrlnpmevikggpgqsswwdkvpskfdgwtanefekagfravpncivrhsayia
pnailmpsfvnlgayvdkgamidtwatvgscaqigknvhlsggvgiggvlepmqagptii
edncfigarsevvegcivregsvlgmgvfigkstkivdratgevfygevppysvvvagtm
pgknvpgenwgpslycavivkradektrsktsinellrd

SCOPe Domain Coordinates for d3eg4a_:

Click to download the PDB-style file with coordinates for d3eg4a_.
(The format of our PDB-style files is described here.)

Timeline for d3eg4a_: