![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Flavobacterium sp. [TaxId:197856] [255817] (5 PDB entries) |
![]() | Domain d3edkb3: 3edk B:518-599 [245854] Other proteins in same PDB: d3edka1, d3edka2, d3edkb1, d3edkb2 automated match to d1h3ga2 complexed with ca, gol |
PDB Entry: 3edk (more details), 1.77 Å
SCOPe Domain Sequences for d3edkb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3edkb3 b.71.1.0 (B:518-599) automated matches {Flavobacterium sp. [TaxId: 197856]} rlmhfgpeentwvyfrynkdkrimvamnnndkpmtlptarfqemlkgapsgvdflsgktv glgrelrlapksvvvielpglp
Timeline for d3edkb3: