Lineage for d3edkb1 (3edk B:3-95)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524658Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1524659Protein automated matches [190226] (39 species)
    not a true protein
  7. 1524735Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries)
  8. 1524743Domain d3edkb1: 3edk B:3-95 [245852]
    Other proteins in same PDB: d3edka2, d3edka3, d3edkb2, d3edkb3
    automated match to d1h3ga1
    complexed with ca, ce8, gol

Details for d3edkb1

PDB Entry: 3edk (more details), 1.77 Å

PDB Description: structural base for cyclodextrin hydrolysis
PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3edkb1 b.1.18.0 (B:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]}
ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
eigpeaqpgsfdivfkgdgrseryryrllareq

SCOPe Domain Coordinates for d3edkb1:

Click to download the PDB-style file with coordinates for d3edkb1.
(The format of our PDB-style files is described here.)

Timeline for d3edkb1: