Lineage for d3edka2 (3edk A:96-517)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830127Protein Cyclomaltodextrinase, central domain [102058] (1 species)
    protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains
  7. 2830128Species Flavobacterium sp. 92 [TaxId:197856] [102059] (6 PDB entries)
  8. 2830135Domain d3edka2: 3edk A:96-517 [245850]
    Other proteins in same PDB: d3edka1, d3edka3, d3edkb1, d3edkb3
    automated match to d1h3ga3
    complexed with ca, gol

Details for d3edka2

PDB Entry: 3edk (more details), 1.77 Å

PDB Description: structural base for cyclodextrin hydrolysis
PDB Compounds: (A:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3edka2 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]}
gsaqrqgfgpgdaiyqimpdrfangdpsndnvagmreqadrrhgggrhggdirgtidhld
yiaglgftqlwptplvendaaaysyhgyaatdhyridprygsnedfvrlstearkrgmgl
iqdvvlshigkhhwwmkdlptpdwinyggkfvptqhhrvavqdpyaaqadsenftkgwfv
egmpdlnqtnplvanyliqnniwwieyaglsglridtygysdgaflteytrrlmaeyprl
nmvgqewstrvpvvarwqrgkanfdgytshlpslmdfplvdamrnalsktgeenglnevy
etlsldylypepqnlvlfggnhdmarmfsaagedfdrwrmnlvflmtmpripqfysgdei
lmtstvkgrddasyrrdfpggwagdkanafsgagltsqqraaqdlvrklanwrknqpvih
ng

SCOPe Domain Coordinates for d3edka2:

Click to download the PDB-style file with coordinates for d3edka2.
(The format of our PDB-style files is described here.)

Timeline for d3edka2: