SCOP 1.57: Domain d1d1ba1: 1d1b A:34-79

Lineage for d1d1ba1 (1d1b A:34-79)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (16 PDB entries)

8. Domain d1d1ba1: 1d1b A:34-79 [24585]
   Other proteins in same PDB: d1d1ba2

Details for d1d1ba1

PDB Entry: 1d1b, 2 Å

PDB Description: dictyostelium myosin s1dc (motor domain fragment) complexed with o,p- dinitrophenyl aminopropyldiphosphate beryllium trifluoride.

SCOP Domain Sequences for d1d1ba1:

Sequence; same for both SEQRES and ATOM records:

>d1d1ba1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

Timeline for d1d1ba1:

• d1d1ba1 first appeared (with stable ids) in SCOP 1.55
  
• d1d1ba1 appears in SCOP 1.59
  
• d1d1ba1 appears in the current release, SCOPe 2.08