![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries) |
![]() | Domain d3edka1: 3edk A:3-95 [245849] Other proteins in same PDB: d3edka2, d3edka3, d3edkb2, d3edkb3 automated match to d1h3ga1 complexed with ca, gol |
PDB Entry: 3edk (more details), 1.77 Å
SCOPe Domain Sequences for d3edka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3edka1 b.1.18.0 (A:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]} ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl eigpeaqpgsfdivfkgdgrseryryrllareq
Timeline for d3edka1: