SCOPe 2.07: Domain d3edjb3: 3edj B:518-599

Lineage for d3edjb3 (3edj B:518-599)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Flavobacterium sp. [TaxId:197856] [255817] (5 PDB entries)

8. Domain d3edjb3: 3edj B:518-599 [245848]
   Other proteins in same PDB: d3edja1, d3edja2, d3edjb1, d3edjb2
   automated match to d1h3ga2
   complexed with bcd, ca, gol

Details for d3edjb3

PDB Entry: 3edj, 1.69 Å

PDB Description: structural base for cyclodextrin hydrolysis

PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edjb3:

Sequence; same for both SEQRES and ATOM records:

>d3edjb3 b.71.1.0 (B:518-599) automated matches {Flavobacterium sp. [TaxId: 197856]}
rlmhfgpeentwvyfrynkdkrimvamnnndkpmtlptarfqemlkgapsgvdflsgktv
glgrelrlapksvvvielpglp

Timeline for d3edjb3:

• d3edjb3 first appeared in SCOPe 2.04
  
• d3edjb3 appears in SCOPe 2.06
  
• d3edjb3 appears in the current release, SCOPe 2.08