SCOPe 2.07: Domain d3edjb2: 3edj B:96-517

Lineage for d3edjb2 (3edj B:96-517)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (33 species)
   not a true protein

7. Species Flavobacterium sp. [TaxId:197856] [255816] (5 PDB entries)

8. Domain d3edjb2: 3edj B:96-517 [245847]
   Other proteins in same PDB: d3edja1, d3edja3, d3edjb1, d3edjb3
   automated match to d1h3ga3
   complexed with bcd, ca, gol

Details for d3edjb2

PDB Entry: 3edj, 1.69 Å

PDB Description: structural base for cyclodextrin hydrolysis

PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edjb2:

Sequence; same for both SEQRES and ATOM records:

>d3edjb2 c.1.8.1 (B:96-517) automated matches {Flavobacterium sp. [TaxId: 197856]}
gsaqrqgfgpgdaiyqimpdrfangdpsndnvagmreqadrrhgggrhggdirgtidhld
yiaglgftqlwptplvendaaaysyhgyaatdhyridprygsnedfvrlstearkrgmgl
iqdvvlshigkhhwwmkdlptpdwinyggkfvptqhhrvavqdpyaaqadsenftkgwfv
egmpdlnqtnplvanyliqnniwwieyaglsglridtygysdgaflteytrrlmaeyprl
nmvgqewstrvpvvarwqrgkanfdgytshlpslmdfplvdamrnalsktgeenglnevy
etlsldylypepqnlvlfggnhdmarmfsaagedfdrwrmnlvflmtmpripqfysgdei
lmtstvkgrddasyrrdfpggwagdkanafsgagltsqqraaqdlvrklanwrknqpvih
ng

Timeline for d3edjb2:

• d3edjb2 first appeared in SCOPe 2.04
  
• d3edjb2 appears in SCOPe 2.06
  
• d3edjb2 appears in the current release, SCOPe 2.08