SCOPe 2.08: Domain d3edjb1: 3edj B:3-95

Lineage for d3edjb1 (3edj B:3-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries)

8. Domain d3edjb1: 3edj B:3-95 [245846]
   Other proteins in same PDB: d3edja2, d3edja3, d3edjb2, d3edjb3
   automated match to d1h3ga1
   complexed with ca, gol

Details for d3edjb1

PDB Entry: 3edj, 1.69 Å

PDB Description: structural base for cyclodextrin hydrolysis

PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edjb1:

Sequence; same for both SEQRES and ATOM records:

>d3edjb1 b.1.18.0 (B:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]}
ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
eigpeaqpgsfdivfkgdgrseryryrllareq

Timeline for d3edjb1:

• d3edjb1 first appeared in SCOPe 2.04
  
• d3edjb1 appears in SCOPe 2.07