SCOPe 2.05: Domain d3edfb3: 3edf B:518-599

Lineage for d3edfb3 (3edf B:518-599)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (30 species)
   not a true protein

7. Species Flavobacterium sp. [TaxId:197856] [255817] (5 PDB entries)

8. Domain d3edfb3: 3edf B:518-599 [245842]
   Other proteins in same PDB: d3edfa1, d3edfa2, d3edfb1, d3edfb2
   automated match to d1h3ga2
   complexed with acx, ca, ce6, gol

Details for d3edfb3

PDB Entry: 3edf, 1.65 Å

PDB Description: structural base for cyclodextrin hydrolysis

PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edfb3:

Sequence; same for both SEQRES and ATOM records:

>d3edfb3 b.71.1.0 (B:518-599) automated matches {Flavobacterium sp. [TaxId: 197856]}
rlmhfgpeentwvyfrynkdkrimvamnnndkpmtlptarfqemlkgapsgvdflsgktv
glgrelrlapksvvvielpglp

Timeline for d3edfb3:

• d3edfb3 first appeared in SCOPe 2.04
  
• d3edfb3 appears in SCOPe 2.06
  
• d3edfb3 appears in the current release, SCOPe 2.08