SCOPe 2.06: Domain d3edfa1: 3edf A:3-95

Lineage for d3edfa1 (3edf A:3-95)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries)

8. Domain d3edfa1: 3edf A:3-95 [245837]
   Other proteins in same PDB: d3edfa2, d3edfa3, d3edfb2, d3edfb3
   automated match to d1h3ga1
   complexed with acx, ca, ce6, gol

Details for d3edfa1

PDB Entry: 3edf, 1.65 Å

PDB Description: structural base for cyclodextrin hydrolysis

PDB Compounds: (A:) cyclomaltodextrinase

SCOPe Domain Sequences for d3edfa1:

Sequence; same for both SEQRES and ATOM records:

>d3edfa1 b.1.18.0 (A:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]}
ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
eigpeaqpgsfdivfkgdgrseryryrllareq

Timeline for d3edfa1:

• d3edfa1 first appeared in SCOPe 2.04
  
• d3edfa1 appears in SCOPe 2.05
  
• d3edfa1 appears in SCOPe 2.07
  
• d3edfa1 appears in the current release, SCOPe 2.08