![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Cyclomaltodextrinase, central domain [102058] (1 species) protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains |
![]() | Species Flavobacterium sp. 92 [TaxId:197856] [102059] (6 PDB entries) |
![]() | Domain d3edeb2: 3ede B:96-517 [245835] Other proteins in same PDB: d3edea1, d3edea3, d3edeb1, d3edeb3 automated match to d1h3ga3 complexed with ca, gol |
PDB Entry: 3ede (more details), 1.71 Å
SCOPe Domain Sequences for d3edeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3edeb2 c.1.8.1 (B:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} gsaqrqgfgpgdaiyqimpdrfangdpsndnvagmreqadrrhgggrhggdirgtidhld yiaglgftqlwptplvendaaaysyhgyaatdhyridprygsnedfvrlstearkrgmgl iqdvvlshigkhhwwmkdlptpdwinyggkfvptqhhrvavqdpyaaqadsenftkgwfv egmpdlnqtnplvanyliqnniwwieyaglsglridtygysdgaflteytrrlmaeyprl nmvgeewstrvpvvarwqrgkanfdgytshlpslmdfplvdamrnalsktgeenglnevy etlsldylypepqnlvlfggnhdmarmfsaagedfdrwrmnlvflmtmpripqfysgdei lmtstvkgrddasyrrdfpggwagdkanafsgagltsqqraaqdlvrklanwrknqpvih ng
Timeline for d3edeb2: