Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (39 species) not a true protein |
Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries) |
Domain d3edeb1: 3ede B:3-95 [245834] Other proteins in same PDB: d3edea2, d3edea3, d3edeb2, d3edeb3 automated match to d1h3ga1 complexed with ca, gol |
PDB Entry: 3ede (more details), 1.71 Å
SCOPe Domain Sequences for d3edeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3edeb1 b.1.18.0 (B:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]} ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl eigpeaqpgsfdivfkgdgrseryryrllareq
Timeline for d3edeb1: