Lineage for d3eddb3 (3edd B:518-599)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804620Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1804621Protein automated matches [226835] (30 species)
    not a true protein
  7. 1804658Species Flavobacterium sp. [TaxId:197856] [255817] (5 PDB entries)
  8. 1804668Domain d3eddb3: 3edd B:518-599 [245830]
    Other proteins in same PDB: d3edda1, d3edda2, d3eddb1, d3eddb2
    automated match to d1h3ga2
    complexed with acx, ca

Details for d3eddb3

PDB Entry: 3edd (more details), 2.65 Å

PDB Description: structural base for cyclodextrin hydrolysis
PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d3eddb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eddb3 b.71.1.0 (B:518-599) automated matches {Flavobacterium sp. [TaxId: 197856]}
rlmhfgpeentwvyfrynkdkrimvamnnndkpmtlptarfqemlkgapsgvdflsgktv
glgrelrlapksvvvielpglp

SCOPe Domain Coordinates for d3eddb3:

Click to download the PDB-style file with coordinates for d3eddb3.
(The format of our PDB-style files is described here.)

Timeline for d3eddb3: