Lineage for d1d0xa1 (1d0x A:34-79)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377724Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2377725Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2377726Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2377759Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries)
  8. 2377763Domain d1d0xa1: 1d0x A:34-79 [24583]
    Other proteins in same PDB: d1d0xa2
    complexed with mg, mnq

Details for d1d0xa1

PDB Entry: 1d0x (more details), 2 Å

PDB Description: dictyostelium myosin s1dc (motor domain fragment) complexed with m- nitrophenyl aminoethyldiphosphate beryllium trifluoride.
PDB Compounds: (A:) myosin s1dc motor domain

SCOPe Domain Sequences for d1d0xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0xa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq

SCOPe Domain Coordinates for d1d0xa1:

Click to download the PDB-style file with coordinates for d1d0xa1.
(The format of our PDB-style files is described here.)

Timeline for d1d0xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d0xa2