Lineage for d3eddb1 (3edd B:3-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766288Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries)
  8. 2766298Domain d3eddb1: 3edd B:3-95 [245828]
    Other proteins in same PDB: d3edda2, d3edda3, d3eddb2, d3eddb3
    automated match to d1h3ga1
    complexed with ca

Details for d3eddb1

PDB Entry: 3edd (more details), 2.65 Å

PDB Description: structural base for cyclodextrin hydrolysis
PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d3eddb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eddb1 b.1.18.0 (B:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]}
ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfvdl
eigpeaqpgsfdivfkgdgrseryryrllareq

SCOPe Domain Coordinates for d3eddb1:

Click to download the PDB-style file with coordinates for d3eddb1.
(The format of our PDB-style files is described here.)

Timeline for d3eddb1: