SCOPe 2.08: Domain d3edcc_: 3edc C:

Lineage for d3edcc_ (3edc C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190296] (11 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187775] (6 PDB entries)

8. Domain d3edcc_: 3edc C: [245823]
   automated match to d1tlfa_
   complexed with hez

Details for d3edcc_

PDB Entry: 3edc, 2.1 Å

PDB Description: Crystal Structure of a 1.6-hexanediol Bound Tetrameric Form of Escherichia coli Lac-repressor Refined to 2.1 Resolution

PDB Compounds: (C:) lactose operon repressor

SCOPe Domain Sequences for d3edcc_:

Sequence; same for both SEQRES and ATOM records:

>d3edcc_ c.93.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq

Timeline for d3edcc_:

• d3edcc_ first appeared in SCOPe 2.04
  
• d3edcc_ appears in SCOPe 2.07