| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Bacillus thuringiensis [TaxId:1428] [255814] (7 PDB entries) |
| Domain d3eb7b3: 3eb7 B:502-652 [245811] Other proteins in same PDB: d3eb7a1, d3eb7a2, d3eb7b1, d3eb7b2, d3eb7c1, d3eb7c2 automated match to d1dlca1 complexed with act, so4 |
PDB Entry: 3eb7 (more details), 2.3 Å
SCOPe Domain Sequences for d3eb7b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eb7b3 b.18.1.0 (B:502-652) automated matches {Bacillus thuringiensis [TaxId: 1428]}
rtntvysdkitqipvvkasdgpkpsanevghylggdpisfnssgstgvirlninsplsqk
yrvrirycssvdfdldvvrggttvnngrfnksapnvgwqslkyenfkfasfstpftfnqa
qdtlkisvrnfssivggsvvyidrielipvn
Timeline for d3eb7b3: