SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3eb7b3 (3eb7 B:502-652)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039963Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2039964Protein automated matches [190770] (33 species)
    not a true protein
  7. 2039974Species Bacillus thuringiensis [TaxId:1428] [255814] (1 PDB entry)
  8. 2039976Domain d3eb7b3: 3eb7 B:502-652 [245811]
    Other proteins in same PDB: d3eb7a1, d3eb7a2, d3eb7b1, d3eb7b2, d3eb7c1, d3eb7c2
    automated match to d1dlca1
    complexed with act, so4

Details for d3eb7b3

PDB Entry: 3eb7 (more details), 2.3 Å

PDB Description: Crystal Structure of Insecticidal Delta-Endotoxin Cry8Ea1 from Bacillus Thuringiensis at 2.2 Angstroms Resolution
PDB Compounds: (B:) Insecticidal Delta-Endotoxin Cry8Ea1

SCOPe Domain Sequences for d3eb7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eb7b3 b.18.1.0 (B:502-652) automated matches {Bacillus thuringiensis [TaxId: 1428]}
rtntvysdkitqipvvkasdgpkpsanevghylggdpisfnssgstgvirlninsplsqk
yrvrirycssvdfdldvvrggttvnngrfnksapnvgwqslkyenfkfasfstpftfnqa
qdtlkisvrnfssivggsvvyidrielipvn

SCOPe Domain Coordinates for d3eb7b3:

Click to download the PDB-style file with coordinates for d3eb7b3.
(The format of our PDB-style files is described here.)

Timeline for d3eb7b3: