Lineage for d3eb7b1 (3eb7 B:64-291)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021084Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 3021108Family f.1.3.0: automated matches [254289] (1 protein)
    not a true family
  6. 3021109Protein automated matches [254672] (2 species)
    not a true protein
  7. 3021110Species Bacillus thuringiensis [TaxId:1428] [255812] (7 PDB entries)
  8. 3021114Domain d3eb7b1: 3eb7 B:64-291 [245809]
    Other proteins in same PDB: d3eb7a2, d3eb7a3, d3eb7b2, d3eb7b3, d3eb7c2, d3eb7c3
    automated match to d1dlca3
    complexed with act, so4

Details for d3eb7b1

PDB Entry: 3eb7 (more details), 2.3 Å

PDB Description: Crystal Structure of Insecticidal Delta-Endotoxin Cry8Ea1 from Bacillus Thuringiensis at 2.2 Angstroms Resolution
PDB Compounds: (B:) Insecticidal Delta-Endotoxin Cry8Ea1

SCOPe Domain Sequences for d3eb7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eb7b1 f.1.3.0 (B:64-291) automated matches {Bacillus thuringiensis [TaxId: 1428]}
iserdavktaislvgtilgklgvplvgpivslystlidvlwpggksqweifmeqvealin
qkiaeyarakalaeleglgnnyqlyltaleewqenpsstrvlrdvrnrfeildslftqym
psfrvtgyevpllsvyaqaanlhllllkdasifgeewgfsttainnyynrqmsliaqysd
hcvqwyrtgldrlkgsnakqwveynrfrremtlsvldimtlfpmydmr

SCOPe Domain Coordinates for d3eb7b1:

Click to download the PDB-style file with coordinates for d3eb7b1.
(The format of our PDB-style files is described here.)

Timeline for d3eb7b1: