Lineage for d3eb7a3 (3eb7 A:502-652)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775002Species Bacillus thuringiensis [TaxId:1428] [255814] (7 PDB entries)
  8. 2775005Domain d3eb7a3: 3eb7 A:502-652 [245808]
    Other proteins in same PDB: d3eb7a1, d3eb7a2, d3eb7b1, d3eb7b2, d3eb7c1, d3eb7c2
    automated match to d1dlca1
    complexed with act, so4

Details for d3eb7a3

PDB Entry: 3eb7 (more details), 2.3 Å

PDB Description: Crystal Structure of Insecticidal Delta-Endotoxin Cry8Ea1 from Bacillus Thuringiensis at 2.2 Angstroms Resolution
PDB Compounds: (A:) Insecticidal Delta-Endotoxin Cry8Ea1

SCOPe Domain Sequences for d3eb7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eb7a3 b.18.1.0 (A:502-652) automated matches {Bacillus thuringiensis [TaxId: 1428]}
rtntvysdkitqipvvkasdgpkpsanevghylggdpisfnssgstgvirlninsplsqk
yrvrirycssvdfdldvvrggttvnngrfnksapnvgwqslkyenfkfasfstpftfnqa
qdtlkisvrnfssivggsvvyidrielipvn

SCOPe Domain Coordinates for d3eb7a3:

Click to download the PDB-style file with coordinates for d3eb7a3.
(The format of our PDB-style files is described here.)

Timeline for d3eb7a3: