Lineage for d3eb7a2 (3eb7 A:292-501)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813112Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 2813125Family b.77.2.0: automated matches [254290] (1 protein)
    not a true family
  6. 2813126Protein automated matches [254673] (3 species)
    not a true protein
  7. 2813127Species Bacillus thuringiensis [TaxId:1428] [255813] (7 PDB entries)
  8. 2813130Domain d3eb7a2: 3eb7 A:292-501 [245807]
    Other proteins in same PDB: d3eb7a1, d3eb7a3, d3eb7b1, d3eb7b3, d3eb7c1, d3eb7c3
    automated match to d1dlca2
    complexed with act, so4

Details for d3eb7a2

PDB Entry: 3eb7 (more details), 2.3 Å

PDB Description: Crystal Structure of Insecticidal Delta-Endotoxin Cry8Ea1 from Bacillus Thuringiensis at 2.2 Angstroms Resolution
PDB Compounds: (A:) Insecticidal Delta-Endotoxin Cry8Ea1

SCOPe Domain Sequences for d3eb7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eb7a2 b.77.2.0 (A:292-501) automated matches {Bacillus thuringiensis [TaxId: 1428]}
typmetkaqltrevytdpigaigaqgswydsapsfntlestfirgkhlfdfitrlsiytg
rssfsasnylkkwighqissqpiggsiqtqtygttsgssviatqqigftgfdvyktlsta
gvlfaytskyygvskvvfdaiypdnkykttftynpgsegigaqekdsevelppetldqpn
yeayshrlnyvtfirnpdvpvfswthrsad

SCOPe Domain Coordinates for d3eb7a2:

Click to download the PDB-style file with coordinates for d3eb7a2.
(The format of our PDB-style files is described here.)

Timeline for d3eb7a2: