| Class b: All beta proteins [48724] (180 folds) |
| Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) ![]() |
| Family b.77.2.0: automated matches [254290] (1 protein) not a true family |
| Protein automated matches [254673] (3 species) not a true protein |
| Species Bacillus thuringiensis [TaxId:1428] [255813] (7 PDB entries) |
| Domain d3eb7a2: 3eb7 A:292-501 [245807] Other proteins in same PDB: d3eb7a1, d3eb7a3, d3eb7b1, d3eb7b3, d3eb7c1, d3eb7c3 automated match to d1dlca2 complexed with act, so4 |
PDB Entry: 3eb7 (more details), 2.3 Å
SCOPe Domain Sequences for d3eb7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eb7a2 b.77.2.0 (A:292-501) automated matches {Bacillus thuringiensis [TaxId: 1428]}
typmetkaqltrevytdpigaigaqgswydsapsfntlestfirgkhlfdfitrlsiytg
rssfsasnylkkwighqissqpiggsiqtqtygttsgssviatqqigftgfdvyktlsta
gvlfaytskyygvskvvfdaiypdnkykttftynpgsegigaqekdsevelppetldqpn
yeayshrlnyvtfirnpdvpvfswthrsad
Timeline for d3eb7a2: