Lineage for d3ea4a2 (3ea4 A:281-459)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2863020Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2863021Protein automated matches [190312] (14 species)
    not a true protein
  7. 2863121Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255811] (2 PDB entries)
  8. 2863122Domain d3ea4a2: 3ea4 A:281-459 [245804]
    Other proteins in same PDB: d3ea4a1, d3ea4a3
    automated match to d1ybha1
    complexed with 2sm, fab, mg, nhe, tdm

Details for d3ea4a2

PDB Entry: 3ea4 (more details), 2.8 Å

PDB Description: Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester
PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d3ea4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ea4a2 c.31.1.0 (A:281-459) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvattlmglgsypc
ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae
igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg

SCOPe Domain Coordinates for d3ea4a2:

Click to download the PDB-style file with coordinates for d3ea4a2.
(The format of our PDB-style files is described here.)

Timeline for d3ea4a2: