SCOPe 2.06: Domain d3ea4a1: 3ea4 A:87-280

Lineage for d3ea4a1 (3ea4 A:87-280)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (20 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255810] (2 PDB entries)

8. Domain d3ea4a1: 3ea4 A:87-280 [245803]
   Other proteins in same PDB: d3ea4a2
   automated match to d1ybha2
   complexed with 2sm, fab, mg, nhe, tdm

Details for d3ea4a1

PDB Entry: 3ea4, 2.8 Å

PDB Description: Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester

PDB Compounds: (A:) Acetolactate synthase, chloroplastic

SCOPe Domain Sequences for d3ea4a1:

Sequence; same for both SEQRES and ATOM records:

>d3ea4a1 c.36.1.0 (A:87-280) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheqg
gvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtdaf
qetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaipn
weqamrlpgymsrm

Timeline for d3ea4a1:

• d3ea4a1 first appeared in SCOPe 2.04
  
• d3ea4a1 appears in SCOPe 2.05
  
• d3ea4a1 appears in SCOPe 2.07
  
• d3ea4a1 appears in the current release, SCOPe 2.08