Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (11 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255811] (2 PDB entries) |
Domain d3e9ya2: 3e9y A:281-459 [245801] Other proteins in same PDB: d3e9ya1, d3e9ya3 automated match to d1ybha1 complexed with 1ms, fab, mg, nhe, tdm |
PDB Entry: 3e9y (more details), 3 Å
SCOPe Domain Sequences for d3e9ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9ya2 c.31.1.0 (A:281-459) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvattlmglgsypc ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg
Timeline for d3e9ya2: