Lineage for d1fmva1 (1fmv A:34-79)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) 
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) 
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (21 PDB entries) 
Domain d1fmva1: 1fmv A:34-79 [24580]
Other proteins in same PDB: d1fmva2
complexed with cl
Details for d1fmva1
PDB Entry: 1fmv (more details), 2.1 Å
PDB Description: crystal structure of the apo motor domain of dictyostellium myosin ii
PDB Compounds: (A:) myosin II heavy chainSCOPe Domain Sequences for d1fmva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmva1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
yiwynpdpkerdsyecgeivsetsdsftfktvdgqdrqvkkddanq
SCOPe Domain Coordinates for d1fmva1:
Click to download the PDB-style file with coordinates for d1fmva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fmva1:
- d1fmva1 first appeared (with stable ids) in SCOP 1.55
- d1fmva1 appears in SCOPe 2.07
View in 3D
