SCOPe 2.06: Domain d3e61b_: 3e61 B:

Lineage for d3e61b_ (3e61 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (70 species)
   not a true protein

7. Species Staphylococcus saprophyticus [TaxId:342451] [225319] (2 PDB entries)

8. Domain d3e61b_: 3e61 B: [245799]
   Other proteins in same PDB: d3e61a2
   automated match to d2rgya_
   complexed with gol

Details for d3e61b_

PDB Entry: 3e61, 2 Å

PDB Description: crystal structure of a putative transcriptional repressor of ribose operon from staphylococcus saprophyticus subsp. saprophyticus

PDB Compounds: (B:) Putative transcriptional repressor of ribose operon

SCOPe Domain Sequences for d3e61b_:

Sequence, based on SEQRES records:

>d3e61b_ c.93.1.0 (B:) automated matches {Staphylococcus saprophyticus [TaxId: 342451]}
liglllpdmsnpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmi
stafneniientltdhhipfvfidrinnehngistnhfkggqlqaevvrkgkgknvlivh
enllidafhqrvqgikyildqqridykmleatlldndkkfidlikelsidsiicsndlla
invlgivqryhfkvpaeiqiigydnipfsemtypqittidqsayhlgeiavsqllglntd
nltnnhkqlaltvkhrgstr

Sequence, based on observed residues (ATOM records):

>d3e61b_ c.93.1.0 (B:) automated matches {Staphylococcus saprophyticus [TaxId: 342451]}
liglllpdmsnpfftliargvedvalahgyqvlignsdndikkaqgylatfvshnctgmi
stafneniientltdhhipfvfidngistnhfkggqlqaevvrkgkgknvlivhenllid
afhqrvqgikyildqqridykmleatlldndkkfidlikelsidsiicsndllainvlgi
vqryhfkvpaeiqiigydnipfsemtypqittidqsayhlgeiavsqllgaltvkhrgst
r

Timeline for d3e61b_:

• d3e61b_ first appeared in SCOPe 2.04
  
• d3e61b_ appears in SCOPe 2.05
  
• d3e61b_ appears in SCOPe 2.07
  
• d3e61b_ appears in the current release, SCOPe 2.08